PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12796A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 402aa    MW: 43325.1 Da    PI: 5.1506
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12796AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-1889134147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg+W++eEd  l ++v++lG ++W++Iar ++ gR++k+c++rw + 
  Oropetium_20150105_12796A  89 RGPWSPEEDAVLSNLVEKLGARNWTLIARGIP-GRSGKSCRLRWCNQ 134
                                89******************************.***********985 PP

2Myb_DNA-binding50.74.1e-16141185147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                r+++T eEd ++  a++ +G++ W++Ia+ +  gRt++ +k++w++ 
  Oropetium_20150105_12796A 141 RKPFTDEEDRIIMAAHAVHGNK-WAAIAKLLV-GRTDNAIKNHWNST 185
                                789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.31684139IPR017930Myb domain
SuperFamilySSF466897.19E-3087182IPR009057Homeodomain-like
SMARTSM007177.4E-1588137IPR001005SANT/Myb domain
PfamPF002494.7E-1789134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2690142IPR009057Homeodomain-like
CDDcd001672.75E-1491133No hitNo description
SMARTSM007174.8E-15140188IPR001005SANT/Myb domain
PROSITE profilePS5129421.912140190IPR017930Myb domain
PfamPF002496.0E-14141185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-23143189IPR009057Homeodomain-like
CDDcd001673.34E-11143186No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MADETAAASP PPPLDPPAAS EPDAEVTHSI SNSMGDESQT PIEPQPQPQP HYSSPPPSGD  60
DDDVTVISSS FAGGDATSGG AEAKREKVRG PWSPEEDAVL SNLVEKLGAR NWTLIARGIP  120
GRSGKSCRLR WCNQLDPQVK RKPFTDEEDR IIMAAHAVHG NKWAAIAKLL VGRTDNAIKN  180
HWNSTLRRRY CNGARCSHSG VVEPAIPETS SAVSEEPLPL GDNTSFNAMD ARNVPAQTVP  240
ETSAGLWQIG AQNYVTETVD PPYLARPAAR IGAFRPYNLG HAESSKHETP ISVFKFDSTL  300
KALNPENDVF KFSDPMCFAA EVPNKCGYGC CSAQERPLKN SLLGPEFNEF EEHPPVLNSS  360
FASLVSEISS IAWMKSGMQI GDASNFFQSA PPAQQSRNHV N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-40881896107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ6013802e-44AJ601380.1 Lolium multiflorum partial mRNA for putative R2R3 MYB transcription factor (myb5 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458769.10.0hypothetical protein SORBIDRAFT_03g039950
TrEMBLA0A0A8ZM400.0A0A0A8ZM40_ARUDO; Uncharacterized protein
STRINGSb03g039950.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89903647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.15e-83myb domain protein 109